PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G1343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 193aa    MW: 22534.5 Da    PI: 10.1059
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G1343genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.8e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+++++ +G ++WktI+   g++R++k+c++rw +yl
      Gh_D05G1343 14 KGAWTAEEDRKLAEVIAVHGAKRWKTIPTIAGLNRCGKSCRLRWMNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.93.7e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
      Gh_D05G1343  67 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 112
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.17965IPR017930Myb domain
SuperFamilySSF466891.76E-2911108IPR009057Homeodomain-like
SMARTSM007171.3E-141363IPR001005SANT/Myb domain
PfamPF002494.7E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-241568IPR009057Homeodomain-like
CDDcd001676.31E-101661No hitNo description
SMARTSM007171.9E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129420.66566116IPR017930Myb domain
PfamPF002491.5E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2569117IPR009057Homeodomain-like
CDDcd001678.34E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MEKNLSLKRF DVNKGAWTAE EDRKLAEVIA VHGAKRWKTI PTIAGLNRCG KSCRLRWMNY  60
LRPNIKRGNI SDQEEDLILR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNS HLSKKVNQKE  120
KHSGASARQG CKFAQQRLVE NAKEQVRQEN TSTGFEESNI SFDVDDFFDF SKVDTRNFEW  180
VNRFLEVDDG FKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29111174109B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.80870.0boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0341310.0AF034131.1 Gossypium hirsutum MYB-like DNA-binding domain protein (MYB3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447716.11e-141PREDICTED: transcription factor MYB114-like
TrEMBLQ94FG31e-141Q94FG3_G
STRINGVIT_09s0002g01380.t013e-87(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.14e-53MYB family protein